Basket

Cart is empty.
Take a look at our collection page.

Continue shopping

GLOW – 70mg – Cartridge Refill

Name: GLOW - 70mg - Cartridge Refill
SKU: 1195/C
Price: 64.95 GBP
Availability: InStock

SKU: 1195/C

£64.95

10 in stock

SKU: 1195/C Categories: Hair, Skin & Nails, Peptides

Key Functions & Benefits

The combined effect of the peptides in a glow blend aims to provide both aesthetic and wellness benefits:

Enhanced Skin Health: Supports skin elasticity, hydration, and tone, leading to a more radiant, “lit-from-within” appearance.
Accelerated Healing: Speeds up recovery from injuries, surgery, or cosmetic procedures like microneedling and lasers.
Reduced Inflammation: The anti-inflammatory properties of BPC-157 and TB-500 can help calm reactive or acne-prone skin and reduce joint discomfort.
Overall Vitality: May support hair and nail strength, improve gut health, and boost energy levels by aiding cellular function.

Description
Technical Data
Delivery
Disclaimer

The Glow Blend is a, often injectable, anti-aging peptide cocktail designed to improve skin texture, increase firmness, and reduce inflammation.

It typically combines GHK-Cu (collagen synthesis), BPC-157 (tissue repair), and TB-500 (healing) to promote a “glow” through cellular regeneration and improved, youthful skin quality.

Glow Peptide Ingredients
The “Glow Blend” generally refers to a stack of several peptides that work together synergistically.

GHK-Cu (Copper Peptide): Often called the “glow peptide” itself, it is known for its role in stimulating collagen and elastin production, improving skin firmness, reducing fine lines, and promoting wound healing.
BPC-157: This peptide is associated with significant tissue repair and healing properties across various parts of the body, including the gut and muscles. It also helps in reducing inflammation.
TB-500 (Thymosin Beta-4 Fragment): This peptide supports cellular migration, regeneration, and tissue remodelling, aiding in recovery and improving mobility and flexibility.

For research use only, not to be used in clinical trials involving humans. Documentation is for information only.

Note:
With this option, we will mix it for you with bacteriostatic water and put it into a cartridge for you to use in your own reusable pen (no vial received).
Reusable pens are sold in the accessories category of our online shop.
You can also buy this cartridge within a disposable pen complete with alcohol swaps and needles all in a case (see alternate product).

Molecular Formula:
– BPC-157: 𝐶62𝐻98𝑁16𝑂22
– TB-500: 𝐶212𝐻350𝑁56𝑂78𝑆
– GHK-Cu: 𝐶14𝐻22𝐶𝑢𝑁6𝑂4
Molecular Weight (combined): 6786 g/mol
CAS Number: GHK-Cu 89030-95-5, BPC-157 137525-51-0, TB-500 77591-33-4
Peptide Sequence:
– BPC-157 sequence: H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH.
– TB-500 sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES.
– GHK-Cu sequence: Gly-His-Lys
Form: Lyophilised powder
Storage: -20°C in freezer
After reconstitution: 2–8°C in fridge
Reconstitute with: Bacteriostatic water (0.9% Benzyl Alcohol)

We deliver to the whole of the UK and N.Ireland, not Europe or the rest of the world.

All orders will be sent using Royal Mail 24 tracked for small orders, APC next day couriers for larger orders.

Orders received before 2pm Monday – Friday will be sent the same day, orders received after 2pm Friday including Saturday and Sunday will be sent on the Monday.

Please include you phone number and/or email address on the payment page so you receive the tracking number and delivery time direct from Royal Mail.

All peptide products supplied are intended strictly for research and laboratory use only. They are not for human or veterinary consumption, therapeutic use, or diagnostic purposes.

By purchasing these products, the buyer acknowledges that they are a qualified researcher and agrees to use the products in accordance with all applicable laws and regulations.

Basket

GLOW – 70mg – Cartridge Refill

Key Functions & Benefits

You May Also Like

GLOW - 70mg

GLOW - 70mg - Premixed Pen